{ $('div[class*="-menu-btn"]').removeClass('active'); "useSimpleView" : "false", "actions" : [ { // Register the click event handler { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); ] { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); { "context" : "", "action" : "rerender" // If watching, pay attention to key presses, looking for right sequence. { "entity" : "1504369", }, "context" : "", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "actions" : [ { } "actions" : [ } { "showCountOnly" : "false", "entity" : "1504002", } // Set start to true only if the first key in the sequence is pressed "action" : "pulsate" "entity" : "2045234", "event" : "expandMessage", } LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "actions" : [ "context" : "", }, { "accessibility" : false, "event" : "removeThreadUserEmailSubscription", "event" : "AcceptSolutionAction", "actions" : [ "disallowZeroCount" : "false", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2045149 .lia-rating-control-passive', '#form_3'); "event" : "removeMessageUserEmailSubscription", ] ] "action" : "rerender" } var key = e.keyCode; return; "includeRepliesModerationState" : "false", } ] { } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); { { { { "actions" : [ { ] LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "rerender" { "event" : "removeThreadUserEmailSubscription", "action" : "pulsate" "action" : "rerender" "displaySubject" : "true", { { "actions" : [ { "context" : "envParam:quiltName,expandedQuiltName", { }, "event" : "MessagesWidgetEditCommentForm", } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_10","menuItemsSelector":".lia-menu-dropdown-items"}}); }, }, { window.location.replace('/t5/user/userloginpage'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); if (isNaN(val) ) CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); { { "event" : "kudoEntity", "}); "selector" : "#messageview_1", "actions" : [ "context" : "envParam:selectedMessage", "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "kudoEntity", { } // We made it! LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); "event" : "editProductMessage", "actions" : [ { "disallowZeroCount" : "false", { ] { "event" : "MessagesWidgetEditCommentForm", "eventActions" : [ "triggerEvent" : "click", "includeRepliesModerationState" : "false", "action" : "rerender" } "action" : "rerender" "context" : "", "action" : "rerender" "actions" : [ } if ( Number(val) < 1 ) "event" : "kudoEntity", } } "action" : "rerender" "actions" : [ } { "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); "messageViewOptions" : "1111110111111111111110111110100101001101" "displaySubject" : "true", "event" : "RevokeSolutionAction", "actions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); "action" : "pulsate" { { }, "disableKudosForAnonUser" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ { "context" : "envParam:quiltName", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", Bei meinen Versicherungen z.B. "context" : "envParam:quiltName,message", { }); }, }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Internet-Endgeraete/thread-id/105641","ajaxErrorEventName":"LITHIUM:ajaxError","token":"nWYmrdIiQLL_vSgy7zxq8JcUYc1KO969OVgw2dPd4Kk. ;(function($) { "action" : "rerender" } ], ] }, { ] "truncateBody" : "true", "action" : "rerender" }, "context" : "envParam:selectedMessage", "actions" : [ { ] Ich habe ein Kabelmodem von Unitymedia mit statischer IP- dahinter hängt eine FritzBox 3490 und dann einUniFI Switch 8 POE-150W. } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); Bist du sicher, dass du fortfahren möchtest? "eventActions" : [ "useCountToKudo" : "false", } } { { }, "selector" : "#kudosButtonV2_8", ] "event" : "RevokeSolutionAction", "action" : "addClassName" } ] { expireDate.setDate(expireDate.getDate() + 365*10); { "truncateBody" : "true", "event" : "markAsSpamWithoutRedirect", { "actions" : [ LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "event" : "approveMessage", ;(function($) { "displaySubject" : "true", "parameters" : { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); { "componentId" : "forums.widget.message-view", "action" : "rerender" "selector" : "#messageview_2", } ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE, SIP- Benutzername, Password und Registrar, Diesen Thema für aktuellen Benutzer floaten, Betreff: SIP- Benutzername, Password und Registrar, alle Daten hatte die Fritzbox von alleine eingestelle. } { { "eventActions" : [ { ] ] { "event" : "QuickReply", }, "event" : "removeThreadUserEmailSubscription", "context" : "", }, ] } "includeRepliesModerationState" : "false", { { "event" : "AcceptSolutionAction", { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_10","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "", "event" : "addThreadUserEmailSubscription", "action" : "rerender" } { })(LITHIUM.jQuery); "parameters" : { { LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); { "actions" : [ } "event" : "markAsSpamWithoutRedirect", "includeRepliesModerationState" : "false", "includeRepliesModerationState" : "false", } { }, { "includeRepliesModerationState" : "false", "; { "componentId" : "kudos.widget.button", ] "event" : "ProductAnswerComment", }, { { ] "actions" : [ window.location = "https://forum.vodafone.de/t5/Internet-Ger%C3%A4te/Fritzbox-7590-mit-Kabelanschluss-einrichten/td-p/2044722" + "/page/" + val; "truncateBodyRetainsHtml" : "false", "action" : "rerender" { "context" : "envParam:selectedMessage", "event" : "AcceptSolutionAction", }, return false; }, "useTruncatedSubject" : "true", { watching = true; ] ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); { "actions" : [ { "action" : "addClassName" "context" : "", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'BvJ7i642am-RW7N3xNbBsedo88FVMjnNGEYp1e5beLY. } "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ { "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", "useSimpleView" : "false", { "useCountToKudo" : "false", { } "actions" : [ "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "initiatorBinding" : true, "eventActions" : [ // just for convenience, you need a login anyways... { ] "event" : "removeThreadUserEmailSubscription", } { LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "context" : "", }, ] "context" : "", "actions" : [ { ] { "kudosable" : "true", "actions" : [ { } function clearWarning(pagerId) { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2045179,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ "eventActions" : [ } "context" : "envParam:quiltName,message,product,contextId,contextUrl", "; { "actions" : [ ] "useTruncatedSubject" : "true", } "event" : "addThreadUserEmailSubscription", }, "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useSubjectIcons" : "true", } }, { { } "actions" : [ "actions" : [ { setWarning(pagerId); "actions" : [ ] }); ] Bevor Sie die Fritzbox einsetzen, sollte das Kabelmodem einsatzbereit und online sein. Bist du sicher, dass du fortfahren möchtest? "event" : "markAsSpamWithoutRedirect", "entity" : "2045149", ] "actions" : [ "showCountOnly" : "false", }, }, }); ] { "useSubjectIcons" : "true", { LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "event" : "MessagesWidgetAnswerForm", } { } Betreff: FW 7.21 für die 6591 ist NICHT da (bei Vo... Betreff: Update Fritz!Box 6591 schlägt ständig feh... Vodafone Station vergisst DHCP Address Pool nach N... FB6591 Kabel-Internet antwortet nicht (Keine Synch... Router Wechsel innerhalb der Vertragslaufzeit, easybox nat verbindungen zu fragwürdigen IP. "event" : "MessagesWidgetEditAction", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_d3756065e8230","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_d3756065e8230_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/Internet-Endgeraete/thread-id/105641&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"HjYWqIcb59aNdUVx2kDzG3Po6Wc-qvBPkFWoOR8DpT4. { //$('#lia-body').removeClass('lia-window-scroll'); }, }); "context" : "", "truncateBodyRetainsHtml" : "false", "action" : "pulsate" if (isNaN(val) ) }, "actions" : [ ] "event" : "ProductAnswer", { }); } { { "context" : "envParam:quiltName,expandedQuiltName", { { "action" : "rerender" LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" "context" : "", ;(function($) { }, "event" : "kudoEntity", })(LITHIUM.jQuery); { { watching = true; "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" { ] "disableLinks" : "false", ] { { "action" : "rerender" "action" : "rerender" "initiatorBinding" : true, "action" : "pulsate" "actions" : [ }, }, }, ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "linkDisabled" : "false" ] ] }, { "actions" : [ "actions" : [ }); "action" : "rerender" }); "context" : "", "action" : "rerender" { { } "context" : "", "actions" : [ { "action" : "addClassName" "actions" : [ }, "componentId" : "kudos.widget.button", { "action" : "rerender" }, }, LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { } ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ //}); "revokeMode" : "true", { ] }, { { } } "disableLabelLinks" : "false", "disableLinks" : "false", "event" : "AcceptSolutionAction", "actions" : [ "actions" : [ LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "", "action" : "rerender" "context" : "", { }, }, "event" : "MessagesWidgetEditAction", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "useSimpleView" : "false", "context" : "envParam:quiltName", "actions" : [ "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", ] "event" : "unapproveMessage", { { "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" }, ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2044722 .lia-rating-control-passive', '#form'); "initiatorDataMatcher" : "data-lia-message-uid" "context" : "", { }); Bist du sicher, dass du fortfahren möchtest? "event" : "MessagesWidgetEditCommentForm", { "eventActions" : [ { } ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "action" : "rerender" "context" : "", "actions" : [ { Fritz Box hinter Kabelmodem einrichten. "event" : "removeThreadUserEmailSubscription", "event" : "addThreadUserEmailSubscription", }, ] { var cookieDomain = 'forum.vodafone.de'; LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); "context" : "", "action" : "pulsate" "componentId" : "forums.widget.message-view", ] //var height = $(window).scrollTop(); { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2044727 .lia-rating-control-passive', '#form_1'); event.preventDefault(); { { ;(function($) { ] "context" : "", { "truncateBody" : "true", { Execute whatever should happen when entering the right sequence ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }); "context" : "", { "initiatorDataMatcher" : "data-lia-message-uid" { "parameters" : { // We made it! "actions" : [ ] ], "parameters" : { "actions" : [ } } { ], LITHIUM.AjaxSupport.ComponentEvents.set({ { ] LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "quiltName" : "ForumMessage", ] "event" : "editProductMessage", } "action" : "rerender" var position_x = msg.offset(); { "closeImageIconURL" : "https://forum.vodafone.de/skins/images/BF72DBD1E1C060C7CF1DE11B5EED1673/responsive_peak/images/button_dialog_close.svg", { { } ] "useTruncatedSubject" : "true", ] ;(function($) { { ], "context" : "", "actions" : [ watching = false; "action" : "rerender" { "event" : "MessagesWidgetEditCommentForm", "message" : "2044727", "parameters" : { { ] "event" : "approveMessage", "truncateBody" : "true", "disableLabelLinks" : "false", })(LITHIUM.jQuery); { { ;(function($) { }); "includeRepliesModerationState" : "false", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", }, { }, } "actions" : [ } "actions" : [ $(document).ready(function(){ }, "context" : "envParam:quiltName,message", { } $(event.data.selector).addClass('cssmenu-open') { }, "parameters" : { "messageViewOptions" : "1111110111111111111110111110100101001101" "parameters" : { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_9","componentSelector":"#lineardisplaymessageviewwrapper_9","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2045314,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { { "actions" : [ // Reset the conditions so that someone can do it all again. "includeRepliesModerationState" : "false", "event" : "ProductAnswerComment", LITHIUM.AjaxSupport.ComponentEvents.set({ ] LITHIUM.Dialog.options['-1560542186'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, { "action" : "rerender" "actions" : [ { "action" : "rerender" "actions" : [ }); "linkDisabled" : "false" "context" : "", ] "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ "actions" : [ }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2045179,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "messageViewOptions" : "1111110111111111111110111110100101001101" o.innerHTML = ""; { { } var watching = false; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_9","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_9","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/105641","ajaxErrorEventName":"LITHIUM:ajaxError","token":"eRSE9RhNkkoY6urUg9F-ZrJgWbz5ANKFWO_6LOxDUSw. "disableLabelLinks" : "false", "context" : "", "kudosLinksDisabled" : "false", } }, "actions" : [ "event" : "MessagesWidgetMessageEdit", } LITHIUM.MessageBodyDisplay('#bodyDisplay_9', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "", "messageViewOptions" : "1111110111111111111110111110100101101101" { } $(document).ready(function(){ } "useSimpleView" : "false", ] "}); ] "actions" : [ { "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" }, ] }, { } { "actions" : [ } }, "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2045241,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { ', 'ajax'); "context" : "", } if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ;(function($) { "event" : "ProductAnswerComment", LITHIUM.AjaxSupport.ComponentEvents.set({ ] "linkDisabled" : "false" function doChecks(pagerId, val) { ;(function($) { function setWarning(pagerId) { "displayStyle" : "horizontal", "event" : "MessagesWidgetEditCommentForm", ] "actions" : [ "actions" : [ "useSubjectIcons" : "true", }, } //} else { }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'ZgZ4hPBR7W378kp4HYDlZvFQlAATg_SuodLfIyxdDHc. { }, }); } { "event" : "removeMessageUserEmailSubscription", ', 'ajax'); "useTruncatedSubject" : "true", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }); } watching = true; "actions" : [ "event" : "addMessageUserEmailSubscription", "event" : "editProductMessage", "; } ] { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234551}); window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1064,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk1+CkFWRlwAQkt+VxBHdFcQcgBGAGpJf0ALFk0GWksZBVAPVhRfCxYaL1RRUV4EWBVaWg4XRBcYVl1cF18FUUYHDGtLQVcZQjkZVAkGVlUFVhcfFlQXVwtcewZADVUHBQACVw5VDAZbVRtGXlBhQQBEL10QWE8GSBdYV2IEUQN3Uw8HFV4XdVtAEFsyVkILAWcFUlYWHkddBXRdAAtbARcJFlQEWhVcEE5AXAd3XEAQXxQAWF4RBxVIF1hXZh0UXBsKVFFVBlNQVR9UUlQKH1ZWUwAYUlFWVhsFAAtaWlUBDQVRVAEUShtZASxYAFB6UBBfFC9XRgcQWQFBHnFcAVEDS1MHFlJGGRFfUTdTFU1kUDNCAUdKFghHZSN1dyE2Fw1RE3JgKntGVFcREVYDUEAUZS1zNHwSFg1HDVYdXVZYCUZ1ey8rY0QKEUlP"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { { { "linkDisabled" : "false" "actions" : [ "entity" : "2045304", "context" : "", ] "kudosable" : "true", ] "context" : "lia-deleted-state", "action" : "rerender" }, { } count = 0; "actions" : [ { "event" : "kudoEntity", "action" : "rerender" } "context" : "", { { "}); { "triggerSelector" : ".lia-panel-dialog-trigger-event-click", return false; "action" : "rerender" "context" : "envParam:quiltName", {